DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd82 and Tsp74F

DIOPT Version :9

Sequence 1:NP_001129527.1 Gene:Cd82 / 12521 MGIID:104651 Length:266 Species:Mus musculus
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:261 Identity:68/261 - (26%)
Similarity:124/261 - (47%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 CVKVTKYFLFLFNLLFFILGAVILGFGVWILADKNSFISVLQTSSSSLQVGA-YVFIGVGAITIV 68
            |.:..||.||:.|.:.|:.||::....:|.|.|: ||::.|  ..::|..|| ||.:....|..:
  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDR-SFVNEL--LGTNLFSGAVYVLLVTSIIICL 71

Mouse    69 MGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANAT 133
            :.||||:||..||:|||..||:.:.|:.:..:..|||.|...:::::    |:...:|:..|...
  Fly    72 VSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQ----TMRQEMRSTMALYG 132

Mouse   134 SSRE--EAWDYVQAQVKCCGWVSHYNWTEN--------EELMGFTK---TTYPCSCEKIKEEDNQ 185
            |.||  :|||..|.:::|||..:.::|...        :||.|..:   |.:|            
  Fly   133 SRREITQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKECTIFP------------ 185

Mouse   186 LIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSIC 250
                         |::.       :..:||:.....:::::..::.|....||::.:.|:..| |
  Fly   186 -------------TITN-------LYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFS-C 229

Mouse   251 L 251
            |
  Fly   230 L 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd82NP_001129527.1 CD37_CD82_like_LEL 106..228 CDD:239413 23/134 (17%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.