DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd63 and Tsp42Er

DIOPT Version :9

Sequence 1:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:225 Identity:63/225 - (28%)
Similarity:103/225 - (45%) Gaps:31/225 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 LYVLLLAFC---ACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGA 75
            |.:..|||.   .|||    :|:|..||...||........|:..:.||||:.:||::|.||.||
  Fly     6 LMIRYLAFLFNFLCAV----LGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFGA 66

Mouse    76 CKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQ 140
            .||:.|  :|:|...|:::::.|::.:. :|||...:.:   |..:..|.:.|...|...:.:.|
  Fly    67 IKESIC--VTWAYATSMLVMLIVSIVML-FVFRMHFEED---SITKLKQAFAKQTNTFDAMAEYQ 125

Mouse   141 KENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNILL 205
            .:..|||.....|:    |.|...||.||...      ||    |.:..||:..:.....:  ||
  Fly   126 TQYQCCGIYKLKDY----GDAYITVPSSCYDQ------ND----TPYRDGCLAKMETQYEE--LL 174

Mouse   206 VAAAALG--IAFVEVLGIIFSCCLVKSIRS 233
            .....:|  :..:|:....||..:..|:|:
  Fly   175 KGPKIVGWMLMVIEIGAFTFSTIMGVSLRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 61/217 (28%)
CD63_LEL 105..203 CDD:239419 23/97 (24%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238 63/225 (28%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 58/212 (27%)
tetraspanin_LEL 93..174 CDD:239401 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.