DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd63 and Tsp39D

DIOPT Version :9

Sequence 1:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:242 Identity:78/242 - (32%)
Similarity:129/242 - (53%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 GGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQ----AITHETTAGSLLPVVIIAVGAFLF 65
            ||:.|||:|.:...|.|....:.:..:|..||:....    ...|..||    |::::.|||.:.
  Fly     4 GGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA----PIILMIVGAAVA 64

Mouse    66 LVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQNYLK-- 128
            ::.|:|||||.||:.|::::||:...:|.|.|:.:.:||||....:.......|...||:|.:  
  Fly    65 VICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERA 129

Mouse   129 DNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCC--INITVG--CGNDFKESTIHTQ 189
            |.:.|..|  ||.|.:|||.:...|||.:  .....:|.:||  ||::..  |.|  ..:|.|  
  Fly   130 DYRDAWTL--LQTELDCCGINGPNDWETV--YRNSTLPAACCSVINLSEAKECTN--THATQH-- 186

Mouse   190 GCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRSGYE 236
            ||::.:...|....|::|:..||:|.:::|.|:|:|||.:|.|..|:
  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSYD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 70/226 (31%)
CD63_LEL 105..203 CDD:239419 30/103 (29%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238 1/3 (33%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 73/230 (32%)
tetraspanin_LEL 104..200 CDD:239401 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 1 1.000 - - otm43294
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.