DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd63 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:246 Identity:78/246 - (31%)
Similarity:131/246 - (53%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 GGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVV---LKQAITHETTAGSL--LPVVIIAVGAFL 64
            |....||:.|:...|.|....:.|||:|..|..|   .|..:     ||..  :|..:|.:|:|:
  Fly     6 GSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFL-----AGKFFSIPTFLIVIGSFI 65

Mouse    65 FLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFR----DQVKSEFNKSFQQQMQN 125
            .:::|.||.||.||||||:::|::.|::|.::|:|..|:|||.|    |.:|:....|..:  .|
  Fly    66 IIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNE--YN 128

Mouse   126 YLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVG------CGNDFKES 184
            .:..|.|..:.|.:|.|..|||.::|.||  |.......:|.||| |:.||      |.|  .:|
  Fly   129 SINPNATTKLWDDIQDEFECCGVTSYNDW--ITAFPNGDLPISCC-NVHVGAVGTFTCNN--AQS 188

Mouse   185 TI---HTQGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIR 232
            ::   |..||::..:.::..:.:.:.||.:.||.::..|:||:|.:.:.|:
  Fly   189 SVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 76/234 (32%)
CD63_LEL 105..203 CDD:239419 32/110 (29%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 76/238 (32%)
tetraspanin_LEL 106..210 CDD:239401 32/110 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5295
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37526
Inparanoid 1 1.050 133 1.000 Inparanoid score I4578
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.