Sequence 1: | NP_031677.1 | Gene: | Cd53 / 12508 | MGIID: | 88341 | Length: | 219 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259266.1 | Gene: | Tsp5D / 31540 | FlyBaseID: | FBgn0029837 | Length: | 287 | Species: | Drosophila melanogaster |
Alignment Length: | 256 | Identity: | 62/256 - (24%) |
---|---|---|---|
Similarity: | 111/256 - (43%) | Gaps: | 46/256 - (17%) |
- Green bases have known domain annotations that are detailed below.
Mouse 1 MGMSSLKLLKYVLFIFNLLFWVCGCCILGFGIYF-LVQNTYGVLFRNLPFLTLGNILVIVGSIIM 64
Mouse 65 VVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQ-HYHSD 128
Mouse 129 N-------STMKAWDFIQTQLQCCGVNGSSDW---TSGP-----PSSC----------------- 161
Mouse 162 ------------PSGADVQGCYNKAKSWFHSNFLYIGIITICVCVIQVLGMSFALTLNCQI 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cd53 | NP_031677.1 | Tetraspannin | 9..210 | CDD:278750 | 60/246 (24%) |
CD53_like_LEL | 104..186 | CDD:239417 | 30/126 (24%) | ||
Tsp5D | NP_001259266.1 | Tetraspannin | 8..256 | CDD:278750 | 60/247 (24%) |
NET-5_like_LEL | 105..228 | CDD:239418 | 30/122 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 140 | 1.000 | Domainoid score | I4733 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 144 | 1.000 | Inparanoid score | I4418 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001172 | |
OrthoInspector | 1 | 1.000 | - | - | otm43438 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X124 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.860 |