DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scarb2 and santa-maria

DIOPT Version :9

Sequence 1:NP_031670.1 Gene:Scarb2 / 12492 MGIID:1196458 Length:478 Species:Mus musculus
Sequence 2:NP_609121.2 Gene:santa-maria / 34024 FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster


Alignment Length:436 Identity:130/436 - (29%)
Similarity:228/436 - (52%) Gaps:35/436 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 DQTIEKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEI---PLLEEVGPYTYRELR 95
            |..:.|.|.|...|:|:.:|:.||:.:.:..|.:|.||||:.  |.:   |:||:||||.:.|..
  Fly    42 DWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDF--GNLSTKPILEQVGPYRFIERP 104

Mouse    96 NKANIQFGENGTTISAVTNKAYVFERNQSVGDPNVDLIRTINIPLLTVVDLAQL--TLLRELIEA 158
            :|.:|.:.....:::......:.|:...|.|..: |.|.|:|...|:....|:.  .:.|.|::.
  Fly   105 DKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLD-DEITTLNAVALSAAATAKYWPPVKRSLVDV 168

Mouse   159 MLKAYQQKLFVIHTVHELLW-GYKDEILSL---VHIFKPDVS---PNFGLFYERNGTND--GEYV 214
            .||.|..::.|..::.|||: ||.|.::.:   :.||..:|.   ..||.||.|||:.|  |.:.
  Fly   169 GLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFN 233

Mouse   215 FLTGEDNYLNFSKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPL-ISKDEVLYLFPSDLCRSVH 278
            ..||.|......::..||.:.:..::.: .|.|.||:.|: |.|. :...:.:.||..|:||::.
  Fly   234 VFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAGE-FQPQHLKPGDSVGLFTPDMCRTIP 296

Mouse   279 ITFSSFENVEGLPAFRYKVPAEILANTS---ENAGFCIPEGNCMDSGVLNISICKNGAPIIMSFP 340
            :.:....::|||..:::......:.|.:   ||..||  .|.|:.|||:|||.|:.|:|:.||:|
  Fly   297 LDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC--GGQCVPSGVMNISSCRFGSPVFMSYP 359

Mouse   341 HFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRKLDDFVETGDIRTMV 405
            ||:.||..:...::|:.||:::||.::.:.|.|||.|..|.|||:|..|..:........|..:.
  Fly   360 HFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIF 424

Mouse   406 FPVMYLNESVLIDKETANQLKSVINTTLVVTNIPYIIMALGVFFGL 451
            ||:::..:.|.|..:.|:|||.          :|.::::..:|.|:
  Fly   425 FPLVWFEQKVRITPDMADQLKV----------LPIVMLSGHIFAGI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scarb2NP_031670.1 CD36 28..455 CDD:279474 130/436 (30%)
Important for interaction with GBA 155..191 11/39 (28%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 130/436 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45589
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.