DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPACA3 and CG16756

DIOPT Version :10

Sequence 1:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:141 Identity:49/141 - (34%)
Similarity:74/141 - (52%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    64 WCPAGI-MLLALVC-LLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFN 126
            |...|: :|||:.| ::|       ||.:.||||||.|.|  ..|:....|::|:||....|..:
  Fly    11 WLGLGLGLLLAIECGVVS-------AKRFLRCELARKLLD--QHGFERSLLSNWICLLEHESDLD 66

Human   127 AAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGL 191
            ...:...|:||.|.|:||||. |:|..  .....:|...|.|.|:.||:::|.||.:| |...|.
  Fly    67 TGRITTNANGSRNYGLFQING-RFCQE--GRRGGICNAKCEDFLDENLRESVTCAKRI-QTSDGF 127

Human   192 GYWEAWRHHCQ 202
            .:|..|:.:|:
  Fly   128 RHWAGWQRYCR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 41/115 (36%)
CG16756NP_572222.2 LYZ_C_invert 30..147 CDD:381618 41/115 (36%)

Return to query results.
Submit another query.