DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd151 and Tsp74F

DIOPT Version :9

Sequence 1:NP_001104519.1 Gene:Cd151 / 12476 MGIID:1096360 Length:253 Species:Mus musculus
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:253 Identity:78/253 - (30%)
Similarity:132/253 - (52%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILV 65
            || |:.:...||.. :||.||..|...::.|..|..:.:|||..:|....||.::.:....|:|:
  Fly     1 MG-FSSRMDCCGQF-VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLL 63

Mouse    66 VAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTM 130
            |..:::.:...|||....||.:.||..|||::.::|:..:|.|:|.||:.:::...:::.::.||
  Fly    64 VTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTM 128

Mouse   131 VKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAG---- 191
            .  .:.|..| ::.|.|..|:...|||.:.   |.|  |.|.|.     ||:|||:.:..|    
  Fly   129 A--LYGSRRE-ITQAWDLTQERLQCCGVDT---WHD--WNRYGP-----VPESCCQELFGGQRKE 180

Mouse   192 CGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLK 249
            |......:|:|  ..||:.....||::|..|||...|.:|.:.:|||||:|.|:..::
  Fly   181 CTIFPTITNLY--NQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd151NP_001104519.1 Tetraspannin 15..248 CDD:278750 73/236 (31%)
CD151_like_LEL 112..220 CDD:239408 30/111 (27%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 72/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5132
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20916
Inparanoid 1 1.050 133 1.000 Inparanoid score I4583
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48589
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 1 1.000 - - FOG0002118
OrthoInspector 1 1.000 - - otm42526
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.