DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd151 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_001104519.1 Gene:Cd151 / 12476 MGIID:1096360 Length:253 Species:Mus musculus
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:243 Identity:69/243 - (28%)
Similarity:120/243 - (49%) Gaps:17/243 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 LKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILVVAGVVVMVTGVLGCC 80
            :||.||.:|..|.:.|:.::|||....|:.:.|...||...:....:::|:...::::: ..||.
  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIIS-FFGCW 74

Mouse    81 ATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSA 145
            ...||...|:..:.::|.|||:||:.|||..||.....:..:|.:|..:: ..|:.......:..
  Fly    75 GALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSL-NEYNSINPNATTKL 138

Mouse   146 VDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCG------KRDHASNIYKV 204
            .|.:|.||.|||..:..||..:  ..:|:     :|.|||...|...|      .:...::.:||
  Fly   139 WDDIQDEFECCGVTSYNDWITA--FPNGD-----LPISCCNVHVGAVGTFTCNNAQSSVADRHKV 196

Mouse   205 EGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEH 252
              ||:.....:|..|...:||.|:.||.:|.||:||.|.:.|.:|:.:
  Fly   197 --GCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIKIRN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd151NP_001104519.1 Tetraspannin 15..248 CDD:278750 68/237 (29%)
CD151_like_LEL 112..220 CDD:239408 26/113 (23%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 68/237 (29%)
tetraspanin_LEL 106..210 CDD:239401 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.