DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSI2 and cocoon

DIOPT Version :10

Sequence 1:XP_005257072.1 Gene:MSI2 / 124540 HGNCID:18585 Length:346 Species:Homo sapiens
Sequence 2:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:173 Identity:49/173 - (28%)
Similarity:81/173 - (46%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    23 MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELD 87
            :.:.|||:.|:...||:||..:|::.:..:.:|..:..|:|||||.|........||.: .|.:|
  Fly   109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSK-RHSID 172

Human    88 SKTIDPKVAFPR---RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNR 149
            .:..:.||...|   ..:|      .|:|||..:.:...:|:::||.:||:|.|..:     ...
  Fly   173 GRWCEVKVPASRGMGNQEP------GKVFVGRCTEDIEADDLREYFSKFGEVIDVFI-----PKP 226

Human   150 HRGFGFVTFENEDVVEKVC---------EIHFHEINNKMVECK 183
            .|.|.||||.:..|...||         .:|....:.|.|:.|
  Fly   227 FRAFSFVTFLDPYVPRVVCGEKHIIKGVSVHVSTADKKNVQNK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSI2XP_005257072.1 RRM1_MSI2 17..109 CDD:410153 25/88 (28%)
RRM2_MSI 111..184 CDD:240769 24/82 (29%)
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 22/72 (31%)
RRM2_TDP43 193..262 CDD:409761 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.