DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4D2 and AdoR

DIOPT Version :9

Sequence 1:NP_001004707.1 Gene:OR4D2 / 124538 HGNCID:8294 Length:307 Species:Homo sapiens
Sequence 2:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster


Alignment Length:368 Identity:68/368 - (18%)
Similarity:135/368 - (36%) Gaps:103/368 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     9 VSDFVFLGL-----------------SQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLH 56
            ::||.|.|.                 |.:.||.....:..:.|.|.:::||:|:||....:.:|.
  Fly     9 ITDFSFEGPLLPLHAATTSKDAKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLR 73

Human    57 TPMYFLLRNLAVLDLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAFD 121
            ....:.:.:||:.||...::..|..::..:...:.:  ..|:..:.....|....:|.|..::.|
  Fly    74 RRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNL--HACLFTVSLLVVLCTISIFCLVAVSVD 136

Human   122 RLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCDV---PQ 183
            |..||..|:.|...:.|:..:.::...||.|.:...        ||..|      ::.||   .:
  Fly   137 RYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGF--------LPLFG------WHADVNHNQE 187

Human   184 VLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMS-----YLFILVMLR----------------- 226
            .|.:...|.:.|.||..:.     ::...||:::     |..|:..:|                 
  Fly   188 CLFVEVMDYNYLVFLYFAT-----IITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSA 247

Human   227 -----------SHPGE------ARRKAASTCTTHIIVVSMIFV----------------PSIYLY 258
                       .|.|.      |.||.....|.::.::.:.|:                |..|::
  Fly   248 AVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVH 312

Human   259 ARPFTPFPMDKLVSIGHTVMTPMLNPMIYTLRNQDMQAAVRRL 301
            .: .|.|    .:.:.|  :...:||::|....:|.:||::.|
  Fly   313 PK-LTLF----CIILSH--LNSAVNPVLYAYHLKDFRAALKNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4D2NP_001004707.1 7tm_4 31..301 CDD:304433 60/327 (18%)
7tm_1 41..287 CDD:278431 54/303 (18%)
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 38/188 (20%)
7tm_1 58..334 CDD:278431 54/303 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.