DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4D2 and TrissinR

DIOPT Version :9

Sequence 1:NP_001004707.1 Gene:OR4D2 / 124538 HGNCID:8294 Length:307 Species:Homo sapiens
Sequence 2:NP_001097092.1 Gene:TrissinR / 33812 FlyBaseID:FBgn0085410 Length:669 Species:Drosophila melanogaster


Alignment Length:239 Identity:59/239 - (24%)
Similarity:99/239 - (41%) Gaps:24/239 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    10 SDFVFLGLSQTRELQRFLFL-MFLFVYITTVMGNILIIITVTSDSQLHTPMYFLLRNLAVLDLCF 73
            |:::|     .|...|.:|: ::..|:.....||:|:|:.||...:|.:...|.|.|||..|.|.
  Fly   174 SEYIF-----DRTDVRIIFITLYTLVFCCCFFGNLLVILVVTLSRRLRSITNFFLANLAFADFCV 233

Human    74 SSVTAPKMLVDLLSEKKTISYQGC-MGQIFFFHFLG-GAMVFFLSVMAFDRLIAISRPLRYVTVM 136
            ......:.|...|.|........| |.|  |.|.|. .|.:|.|.|:..:|..||..|:....::
  Fly   234 GLFCVMQNLSIYLIESWVFGEFLCRMYQ--FVHSLSYTASIFILVVICMERYFAIVHPITCKQIL 296

Human   137 NTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLKIS 201
            .......::|..|:...|:|..:        |.....:.|.:....|...:...|..:.      
  Fly   297 TAARLRMVIVTVWITSAVYSTPK--------FVFSKTIKNIHTQDGQEEEICVLDREMF------ 347

Human   202 NSGLLDVVWFFLLLMSYLFILVMLRSHPGEARRKAASTCTTHII 245
            ||.|||::.|.||.:..|.::.:|.|....|..:::...|.|::
  Fly   348 NSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSSRGLTPHVV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4D2NP_001004707.1 7tm_4 31..301 CDD:304433 54/217 (25%)
7tm_1 41..287 CDD:278431 53/207 (26%)
TrissinRNP_001097092.1 7tm_4 191..>327 CDD:304433 37/145 (26%)
7tm_1 201..>385 CDD:278431 51/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.