DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4D2 and ser-1

DIOPT Version :9

Sequence 1:NP_001004707.1 Gene:OR4D2 / 124538 HGNCID:8294 Length:307 Species:Homo sapiens
Sequence 2:NP_001024728.1 Gene:ser-1 / 181716 WormBaseID:WBGene00004776 Length:683 Species:Caenorhabditis elegans


Alignment Length:158 Identity:43/158 - (27%)
Similarity:76/158 - (48%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    27 LFLMFLFVYITTVMGNILIIITVTSDSQLHTPMYFLLRNLAVLDLCFSSVTAP-KMLVDLLSEKK 90
            |||:.:...| .::||.|:.:.:.:|.:||....:.|.:||:.||....:..| .::|::.....
 Worm    59 LFLLPVLCLI-GLIGNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIVVEVRHGVW 122

Human    91 TISYQGCMGQIFFFHFLGGAMVFFLSVMAFDRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVH 155
            |.|...|:..::...||..|.:..:||::.||.:.||:|||......|.:::.:.: .||     
 Worm   123 TWSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLRTRNRSKTLIFIKIAI-VWV----- 181

Human   156 SIVQLALMLPLPFCG----PNILDNFYC 179
              |.|.:..|:....    .|||.|..|
 Worm   182 --VTLLVSCPIAVLAMHDTANILRNNQC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4D2NP_001004707.1 7tm_4 31..301 CDD:304433 40/154 (26%)
7tm_1 41..287 CDD:278431 39/144 (27%)
ser-1NP_001024728.1 7tmA_5-HT2 56..438 CDD:320180 43/158 (27%)
TM helix 1 57..83 CDD:320180 7/24 (29%)
TM helix 2 90..116 CDD:320180 6/25 (24%)
TM helix 3 129..159 CDD:320180 8/29 (28%)
TM helix 4 170..193 CDD:320180 6/30 (20%)
TM helix 5 211..240 CDD:320180
TM helix 6 365..395 CDD:320180
TM helix 7 406..431 CDD:320180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.