DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccni and CycB3

DIOPT Version :9

Sequence 1:NP_059063.2 Gene:Ccni / 12453 MGIID:1341077 Length:377 Species:Mus musculus
Sequence 2:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:136 Identity:35/136 - (25%)
Similarity:60/136 - (44%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 IPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLNCIAISCFFLA 98
            :|...:::...|..::.|:.:::..|.|..||..||..::|.:|.....:.:.|..:..:.||:|
  Fly   326 MPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIA 390

Mouse    99 AKTVEEDEKIPVLKVLARDSFCGCSSS----EILRMERIILDKLNWDLHTATPLDFLHIFHAIAV 159
            .|   .||:.|   .|..|....|..:    |::||||..|..:.:||.......||..:...|.
  Fly   391 CK---YDERQP---PLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAK 449

Mouse   160 SARPQL 165
            ...|.|
  Fly   450 VPMPTL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CcniNP_059063.2 Cyclin_N 39..142 CDD:365896 27/106 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..377
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 29/112 (26%)
Cyclin_C 435..555 CDD:281044 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.