DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccnd1 and CycE

DIOPT Version :10

Sequence 1:NP_001366177.1 Gene:Ccnd1 / 12443 MGIID:88313 Length:317 Species:Mus musculus
Sequence 2:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster


Alignment Length:171 Identity:34/171 - (19%)
Similarity:52/171 - (30%) Gaps:50/171 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse   950 FQLTEAQFAHLLSLLGFDSDLKQLPYLDFLKHLVGPPVSSWSVFDPSQGLPVASSEEMKDGEELS 1014
            :.:.:.:.|.|..::..|.|||.|                             ..:..|...|..
  Fly    76 YWMPQTEAAKLSYIVPADVDLKPL-----------------------------QVQHAKQLNEWW 111

Mouse  1015 PGRAIQRVKELVTTSSDTLFKAFSAFDRTGDGMIPQAEFRQVLDHFCMRLSDVQFKKLLSELRLN 1079
            |.|  .|..:....|:...|.||..||:| .|.:....|:.  ||      |..........|.|
  Fly   112 PYR--YRTSQQYFESAIKYFGAFGLFDKT-SGELVACVFQN--DH------DAVGHLYTVPERCN 165

Mouse  1080 EG----------EELGVNWKEFLQVFNLHNEETADEWLKKI 1110
            .|          :.:.|.:|:.:..|...|.|.:.....||
  Fly   166 RGYGCTLAKAITKHIAVQYKQDVHTFIDGNNERSIRLFNKI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccnd1NP_001366177.1 CYCLIN_CCND1_rpt1 3..151 CDD:410276
CYCLIN_CCND1_rpt2 156..287 CDD:410279
CycENP_001246037.1 CYCLIN_CCNE_rpt1 327..459 CDD:410223
CYCLIN_CCNE_rpt2 463..576 CDD:410224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.