DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDYL2 and HP1e

DIOPT Version :10

Sequence 1:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens
Sequence 2:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster


Alignment Length:71 Identity:24/71 - (33%)
Similarity:36/71 - (50%) Gaps:14/71 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    43 VERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFID------------EFNGLHMS 95
            ||||:| |::..|:.:||::|..|...::|||.... |.|...||            |.|..:.:
  Fly    29 VERILD-RRHYMGQLQYLVKWLDYSDEDNTWESAAD-LDCHSLIDSIESQKSLKRGQELNNQYET 91

Human    96 KDKRIK 101
            |.||:|
  Fly    92 KAKRLK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDYL2XP_011521168.1 CD_CDY 42..91 CDD:349284 19/59 (32%)
crotonase-like 286..482 CDD:119339
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274 16/43 (37%)
CSD_HP1e_insect 111..163 CDD:349337
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.