DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDYL2 and CG8289

DIOPT Version :10

Sequence 1:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens
Sequence 2:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster


Alignment Length:123 Identity:36/123 - (29%)
Similarity:58/123 - (47%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    23 AQPRGARSPRRRPL-----PSRVEEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHC 82
            |:.||.|:...:..     |.:..|||:|:|....|:|.. :.||||.||..:|:|||..:|. |
  Fly   210 AKGRGRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDM-FKIRWKKYGPKDDSWEPSKNLA-C 272

Human    83 EEFIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKR 140
            :..|::|        .|.::.:::...|.||:|     .|.:.|..|....:...|.|
  Fly   273 DALIEKF--------MRKQATQENVDVKELRES-----PKKTERLVDECYPRTNLHNR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDYL2XP_011521168.1 CD_CDY 42..91 CDD:349284 21/48 (44%)
crotonase-like 286..482 CDD:119339
CG8289NP_573229.1 CD_CSD 233..281 CDD:349274 21/57 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.