DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDYL2 and swi6

DIOPT Version :9

Sequence 1:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens
Sequence 2:NP_593449.1 Gene:swi6 / 2541633 PomBaseID:SPAC664.01c Length:328 Species:Schizosaccharomyces pombe


Alignment Length:265 Identity:62/265 - (23%)
Similarity:95/265 - (35%) Gaps:82/265 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    41 EEVERIVDK-----RKNKKGKWEYLIRWKGYGSTED-TWEPEHHLLHCEEFIDEFNGLH-----M 94
            ||.|.:|:|     ...|.|.:|||::|:||....| ||..|.....|::.|:.:...|     .
pombe    77 EEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEP 141

Human    95 SKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGK-SKGTSHKRKRIN-------------- 144
            ||.||....|:.       :::.||.:.   |.:|..| .|.::.|.:.:|              
pombe   142 SKRKRTARPKKP-------EAKEPSPKS---RKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEF 196

Human   145 ----PPLAKPKKGY------SGKPSSGGDRATKTVSYRTTPSGLQIMPLKK-------------- 185
                ||..:| .|:      |..||......::.:....|||  .:.|.||              
pombe   197 NENGPPSGQP-NGHIESDNESKSPSQKESNESEDIQIAETPS--NVTPKKKPSPEVPKLPDNREL 258

Human   186 ----------------SQNGMENGDAGSEKDERHFGNG--SHQPGLDLNDHVGEQDMGECDVNHA 232
                            |.:.:|..|.|:.:....:.||  ||.|....|... .|.|.:...:|.
pombe   259 TVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKC-PQKMLQFYESHL 322

Human   233 TLAEN 237
            |..||
pombe   323 TFREN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDYL2XP_011521168.1 CHROMO 40..89 CDD:214605 19/53 (36%)
crotonase-like 286..482 CDD:119339
swi6NP_593449.1 CHROMO 85..134 CDD:237991 15/48 (31%)
ChSh 261..326 CDD:197638 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.