DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbx3 and HP1b

DIOPT Version :9

Sequence 1:NP_001341931.1 Gene:Cbx3 / 12417 MGIID:108515 Length:183 Species:Mus musculus
Sequence 2:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster


Alignment Length:154 Identity:87/154 - (56%)
Similarity:109/154 - (70%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    29 EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKS 93
            ||.||:|.|:|.|||:.||:|||||:..::|||||.||||||:||..|..|.|..|::  ||::.
  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKE--TKKRL 65

Mouse    94 LSDSESDDSKSKKKRDAAD------KPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVL 152
            .:.|..:..:||:|....|      |..||.|||:..:|:|||||||.||||||||.||.||||.
  Fly    66 STSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVP 130

Mouse   153 AKEANMKCPQIVIAFYEERLTWHS 176
            ||.||.:|||:||.|||||||||:
  Fly   131 AKLANTRCPQVVIQFYEERLTWHT 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbx3NP_001341931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
CD_HP1gamma_Cbx3 29..78 CDD:349299 31/48 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..125 16/52 (31%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 41/56 (73%)
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 31/48 (65%)
Chromo_shadow 100..151 CDD:279701 36/50 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833132
Domainoid 1 1.000 90 1.000 Domainoid score I7745
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I4037
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52905
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm42322
orthoMCL 1 0.900 - - OOG6_104220
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8954
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.