DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbx2 and rhi

DIOPT Version :9

Sequence 1:XP_006532166.1 Gene:Cbx2 / 12416 MGIID:88289 Length:594 Species:Mus musculus
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:308 Identity:62/308 - (20%)
Similarity:96/308 - (31%) Gaps:116/308 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse    74 SREHEKEVQ----------NRKRGKRPRGRPRKHTVTSSCSRRSKLKASTATGNREPCSCYPGAS 128
            :::|.|.||          |:|:||..:                    .|| |..:....||...
  Fly   112 TQQHSKSVQAKNTAGMSKMNQKKGKNIK--------------------KTA-GKIKDIENYPKTQ 155

Mouse   129 SGAASPSTSPFCALSSRIAAAALLDHAQLPLALETLHQGSQRAEPDAPSKSKSSSSSSSSTSSSS 193
                .||||.....|:.:     .|                 ..|.|.:.:...|....|..|..
  Fly   156 ----MPSTSQVSTDSTEV-----FD-----------------GNPSATTTNMIKSPRIQSLFSDL 194

Mouse   194 SSDEEEDDSDLDSKRGPRGRETHPVPQKKAQILVAKPELKD-PIRKKRG-----RKPLPPEQKAA 252
            :..|...|.|:    |....:|.|    |::.|:..|:.:| |:..|..     ||...|.|.:.
  Fly   195 NLIEPTKDKDV----GDTSLKTPP----KSRRLIEFPQREDAPLSSKHVSPMLIRKESQPLQSSC 251

Mouse   253 RRPVSLAKVLKTTRKDLGTSAAKLPPPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGM 317
                       |...|||.|::.:..|..:..:...::|.          |.:.|:.|..:.  .
  Fly   252 -----------TDDSDLGESSSSMSLPTVSSTSSEKSIKV----------TKSEPKTLGQIK--F 293

Mouse   318 AGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKAQATNKCGLGLDL 365
            :...|.||                  .|||.|.    |..:..:||||
  Fly   294 SSRSSDGG------------------HAASSLG----APKEGDIGLDL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbx2XP_006532166.1 CBX7_C 553..585 CDD:375056
rhiNP_536794.1 CHROMO 22..72 CDD:237991
ChSh 357..411 CDD:294039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.