powered by:
Protein Alignment Cbx2 and HP1e
DIOPT Version :9
Sequence 1: | XP_006532166.1 |
Gene: | Cbx2 / 12416 |
MGIID: | 88289 |
Length: | 594 |
Species: | Mus musculus |
Sequence 2: | NP_649878.1 |
Gene: | HP1e / 41108 |
FlyBaseID: | FBgn0037675 |
Length: | 174 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 15/49 - (30%) |
Similarity: | 21/49 - (42%) |
Gaps: | 13/49 - (26%) |
- Green bases have known domain annotations that are detailed below.
Mouse 195 SDEE---EDDSDLD----------SKRGPRGRETHPVPQKKAQILVAKP 230
|||: |..:||| .|...||:|.:...:.||:.|...|
Fly 52 SDEDNTWESAADLDCHSLIDSIESQKSLKRGQELNNQYETKAKRLKIDP 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.