DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbx2 and HP1e

DIOPT Version :9

Sequence 1:	XP_006532166.1	Gene:	Cbx2 / 12416	MGIID:	88289	Length:	594	Species:	Mus musculus
Sequence 2:	NP_649878.1	Gene:	HP1e / 41108	FlyBaseID:	FBgn0037675	Length:	174	Species:	Drosophila melanogaster

Alignment Length:	49	Identity:	15/49 - (30%)
Similarity:	21/49 - (42%)	Gaps:	13/49 - (26%)

- Green bases have known domain annotations that are detailed below.

Mouse   195 SDEE---EDDSDLD----------SKRGPRGRETHPVPQKKAQILVAKP 230
            |||:   |..:|||          .|...||:|.:...:.||:.|...|
  Fly    52 SDEDNTWESAADLDCHSLIDSIESQKSLKRGQELNNQYETKAKRLKIDP 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbx2	XP_006532166.1	CBX7_C	553..585	CDD:375056
HP1e	NP_649878.1	CHROMO	25..67	CDD:237991	7/14 (50%)
HP1e	NP_649878.1	Chromo_shadow	113..164	CDD:279701
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920