powered by:
Protein Alignment Cbx2 and Oxp
DIOPT Version :9
Sequence 1: | XP_006532166.1 |
Gene: | Cbx2 / 12416 |
MGIID: | 88289 |
Length: | 594 |
Species: | Mus musculus |
Sequence 2: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 12/39 - (30%) |
Similarity: | 19/39 - (48%) |
Gaps: | 4/39 - (10%) |
- Green bases have known domain annotations that are detailed below.
Mouse 58 EKGLQAGLLKADWRCVSREHEKEVQNRKRGKR-PRGRPR 95
:|.:..|| ..|.|..:..:.:..:..||| .||||:
Fly 3 QKSIDLGL---GVRNVKEKSSEYIVEKFLGKRYLRGRPQ 38
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cbx2 | XP_006532166.1 |
CBX7_C |
553..585 |
CDD:375056 |
|
Oxp | NP_611240.1 |
CHROMO |
21..72 |
CDD:237991 |
7/18 (39%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.