DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbx2 and CG8289

DIOPT Version :9

Sequence 1:XP_006532166.1 Gene:Cbx2 / 12416 MGIID:88289 Length:594 Species:Mus musculus
Sequence 2:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster


Alignment Length:216 Identity:54/216 - (25%)
Similarity:78/216 - (36%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 KLDRQWGSLGNG-GWRLKPEKGLQAGLLKADWRCVSREHEKEVQN--------RKRGKRPRGRPR 95
            ::|:| .|.|.| ..|..|.|      .||.....|...:.:.|.        ..|.||..|:.|
  Fly    25 EIDQQ-KSNGTGRSSRKTPNK------RKAKLTVASDSEDSDCQTSTSNVDVPAARNKRKVGKAR 82

Mouse    96 KHTVTSSCSRRSKLKASTATGNREPCSCYPGASSGAASPSTSPFCALSSRIAAAALLDHAQLPLA 160
            ..| ||......|:....:..:.......|.|.|....|:..   ..:.|.......|..:||  
  Fly    83 NAT-TSPRKNGKKIVIEDSDDDANHSDVDPSADSSPRKPNIK---RQTRRSVRGETEDSNELP-- 141

Mouse   161 LETLHQGSQRAEPDAPS---KSKSSSSSSSSTSSSSSSDEEEDDSDLDSKRGPRGRETHPVPQKK 222
                  .:.:|...|.|   |.|.|.:|:||..:.....|::.:||:|:  |... |....|||.
  Fly   142 ------STSKASAHASSPIKKRKLSRASTSSVKNGKKVAEKDSESDVDA--GTED-EKSAQPQKV 197

Mouse   223 AQILVAKPELKDPIRKKRGRK 243
            |....:.|..|.  .|.|||:
  Fly   198 AAKSKSSPNAKK--AKGRGRR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbx2XP_006532166.1 CBX7_C 553..585 CDD:375056
CG8289NP_573229.1 CHROMO 233..284 CDD:214605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.