DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbx2 and HP1b

DIOPT Version :9

Sequence 1:XP_006532166.1 Gene:Cbx2 / 12416 MGIID:88289 Length:594 Species:Mus musculus
Sequence 2:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster


Alignment Length:280 Identity:55/280 - (19%)
Similarity:82/280 - (29%) Gaps:112/280 - (40%)


- Green bases have known domain annotations that are detailed below.


Mouse   289 ALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKA 353
            :||.:.||.....||.:|||::.|..|......:..   |..::.:...:..|::..|       
  Fly    53 SLKNNKKETKKRLSTSSTPESIRSKRKSFLEDDTEE---QKKLIGFERGLEASKILGA------- 107

Mouse   354 QATNKCGLGLDLKVRTQKGGEL------GGSPAGGKVPKAPGGGAAEQQRGNHSGSPGAQLAPTQ 412
                           |...|.|      .||.....||                    |:||.|:
  Fly   108 ---------------TDSSGHLMFLMKWKGSDHADLVP--------------------AKLANTR 137

Mouse   413 --ELSLQVLDLQSVKNGVPGVGLLARHAPAKAIPATNPATGKGPGSGPTGANMTNAPTDNNKGEK 475
              ::.:|..:.:           |..|            ||.|.|:|.|  |..|..:....|  
  Fly   138 CPQVVIQFYEER-----------LTWH------------TGSGNGNGNT--NSVNLGSSGGLG-- 175

Mouse   476 LTCKATALPAPSVKRDTVKSVAASGGQEGHTAPGEGRKPPALSELSTGEENSSSDSDPDSTSLPS 540
                               ||..||..: .||||           |.|.....|:.|......|.
  Fly   176 -------------------SVGGSGAGD-DTAPG-----------SVGTTGGGSNIDGGDEEDPE 209

Mouse   541 AAQNLSVAIQTSQDWKPTRS 560
            .|..:. :|...::.||..|
  Fly   210 PASPIG-SINQDENIKPDES 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbx2XP_006532166.1 CBX7_C 553..585 CDD:375056 3/8 (38%)
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605
Chromo_shadow 100..151 CDD:279701 14/103 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.