DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbx1 and Skadu

DIOPT Version :10

Sequence 1:NP_031648.1 Gene:Cbx1 / 12412 MGIID:105369 Length:185 Species:Mus musculus
Sequence 2:NP_001162985.1 Gene:Skadu / 8673966 FlyBaseID:FBgn0259922 Length:133 Species:Drosophila melanogaster


Alignment Length:91 Identity:25/91 - (27%)
Similarity:41/91 - (45%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    99 KPKKK--KEESEKP-----RGFARGLEPERIIGATDSSGELMFL-MKWKNSDEADLVPAKEANVK 155
            ||.||  .:.:..|     ..|.||.:.|.|:....:..:..|| :|:.|..|.:|||.:.|...
  Fly    41 KPVKKFSSDLANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLELALQH 105

Mouse   156 CPQVVISFYEERL-TWHSYPSEDDDK 180
            .|.::..||:|.: .|.....:..|:
  Fly   106 VPHLLSDFYKEYVQAWQKMEQQKYDE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbx1NP_031648.1 CD_HP1beta_Cbx1 20..69 CDD:349297
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 10/31 (32%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 18/58 (31%)
SkaduNP_001162985.1 CSD 66..116 CDD:349275 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.