DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbx1 and HP1Lcsd

DIOPT Version :10

Sequence 1:NP_031648.1 Gene:Cbx1 / 12412 MGIID:105369 Length:185 Species:Mus musculus
Sequence 2:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster


Alignment Length:69 Identity:27/69 - (39%)
Similarity:40/69 - (57%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse   113 FARGLEPERIIGA-TDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSE 176
            |.||...|:|:.. |.::...|||:|:|:|...::||..|||.:.||:||.||.:.|   |.|..
  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHL---SLPPP 67

Mouse   177 DDDK 180
            :..|
  Fly    68 ESRK 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbx1NP_031648.1 CD_HP1beta_Cbx1 20..69 CDD:349297
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 5/10 (50%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 23/56 (41%)
HP1LcsdNP_001246478.1 CSD 10..62 CDD:349275 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.