DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina6 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:403 Identity:110/403 - (27%)
Similarity:191/403 - (47%) Gaps:45/403 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 YTCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALA 70
            |.|:|      ||.|........               .:|:.|...::::|.::|||||...|:
  Fly     3 YLCIF------LWVTSVACQTSK---------------EIYQLLSKSHTNQNLVVSPVSIETILS 46

Mouse    71 MLSLSTRGST--QYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLK 133
            |:.:...|||  :....||. .|:..||...:....||. ||..:.|..:.:.|.:::.....|.
  Fly    47 MVFMGAEGSTAKELQSALGL-PSEDKEAVAARYGALLND-LQGQEEGPILKLANRIYVNDQYSLN 109

Mouse   134 DSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVV--SDLDSSATLILINYIFL 196
            .::....:..::|||.:|...:...|.|:||..|.::|.|||:.::  ..:.|....:|:|.|:.
  Fly   110 QNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYF 174

Mouse   197 KGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNI--SYFRDSAIPCQMVQMNYVGNGTTF-I 258
            ||.|:..|.|..||...|.|....:|.|.||.|.|..  :||||  :..|::::.|:.:..:. |
  Fly   175 KGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTI 237

Mouse   259 ILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSD 323
            .||.:.:   .::|| .:.|..:.:.::.:::.|.:|||.:....:|::.|..:||::|||::||
  Fly   238 FLPREVE---GLSAL-EEKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSD 298

Mouse   324 ----FADTTKDTPLTLTVLHKAMLQL-DEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKY 383
                |||  |.......|.|||.|:: :||.....||:....:....|..|..:.||.|:..|..
  Fly   299 LSGLFAD--KSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDAN 361

Mouse   384 TWSSLMMSQVMNP 396
            |  .....:|::|
  Fly   362 T--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 103/364 (28%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 102/379 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.