DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina6 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:386 Identity:98/386 - (25%)
Similarity:182/386 - (47%) Gaps:61/386 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 DFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQ----YLENLGFNMSKMSEAEIHQ 100
            ||:..|.|::..:....|...||.|...||.:...|:...|:    ...|||:.::|.       
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ------- 97

Mouse   101 GFQYLNS--LLQQSD------TGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWT 157
              |.|.|  |.|:.|      :.:|::..|.:|:.:.:.:.:.|  :|..|..::.|..  |:..
  Fly    98 --QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF--NTLLYGATKELDF--KNDP 156

Mouse   158 KAG-EQINNHVKNKTQGKIEHVVS--DLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNET 219
            :.| ::||:.:.:||..:|..::|  ::.....|:|.|..::||.|...|..|.|..:.|::||.
  Fly   157 ETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINER 221

Mouse   220 STVKVPMMVQSGNISYFRDSAIPCQMVQMNY----------------VGNGTTFIILPDQGQ--M 266
            ....|.||.::|......|..:..|::::.|                ..:.:..||||:..:  :
  Fly   222 EQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISL 286

Mouse   267 DTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDT 331
            :.|::.||.|::.:|.:..:|:::.|.:|||......:|..:|:.:|:..:||..:.|.|.|.| 
  Fly   287 NRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD- 350

Mouse   332 PLTLTV---LHKAMLQLDE-GNVLPAATNGPPVHLPSES------FTLKYNRPFIFLAFDK 382
            |::|.:   .|.|.:::|| |:...|||    :.|.|.|      .....|.||:||.:|:
  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAAT----ILLVSRSSRQPDPTKFNCNHPFVFLIYDE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 96/383 (25%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.