DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Runx3 and RunxA

DIOPT Version :9

Sequence 1:NP_062706.2 Gene:Runx3 / 12399 MGIID:102672 Length:423 Species:Mus musculus
Sequence 2:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster


Alignment Length:394 Identity:154/394 - (39%)
Similarity:191/394 - (48%) Gaps:88/394 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    68 RSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENY 132
            |::.|.|.:|.|||:||.||.|:|:|||.|||.|||||||||||:|||:.|||:|||.|||||||
  Fly    86 RTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENY 150

Mouse   133 SAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR- 196
            .|||||.:||||||||:||||||||||||||||||||||.|||..:|||::||||||||||||| 
  Fly   151 CAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRS 215

Mouse   197 RHRQKIEDQTKAFPDRFGDLRMRVTPSTPSPRGSLSTTSHFSSQAQTPIQGSSD-LNPFSDPRQF 260
            :....:..|.:.|...||                           |.|...|:| |:.|..|   
  Fly   216 KTMLSLLGQQQQFHFAFG---------------------------QRPFHFSTDPLSGFRMP--- 250

Mouse   261 DRSFPTLQSLTESRFPDPRMHYPGAMSAAFPYSATPSGTSLGSLSVAGMPASSRFHHTYLPPPYP 325
              .....||.:.:.:     .|..|.||..||.|: ||     ||....|.|::|::..|.....
  Fly   251 --PIGNCQSASNTHW-----GYGSAASAYSPYLAS-SG-----LSSCTTPTSAQFNNPALGFTCS 302

Mouse   326 GAPQSQSGPF---------------QANPAPYHL--FYGASSGSYQFSMAAAGGGERSPTRMLTS 373
            ...||.:..|               .|:....||  ..|::||..........||:.|.:..:..
  Fly   303 SNDQSNNQDFGGATNRDCVPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNG 367

Mouse   374 CPSGASVSAGNLMNPSLGQADGVEADG-----------------------SHSNSPTALSTPGRM 415
            ...|.|..||....   |...|..|.|                       |..|.|.:||...:.
  Fly   368 ASGGGSAGAGTAGG---GAGSGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQNGPRSLSDSSQA 429

Mouse   416 DEAV 419
            :..|
  Fly   430 ESPV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Runx3NP_062706.2 Runt 77..198 CDD:279225 97/121 (80%)
RunxI 328..423 CDD:285676 26/132 (20%)
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/120 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2765
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8706
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.