DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp9 and Dcp-1

DIOPT Version :9

Sequence 1:NP_056548.2 Gene:Casp9 / 12371 MGIID:1277950 Length:454 Species:Mus musculus
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:307 Identity:100/307 - (32%)
Similarity:141/307 - (45%) Gaps:49/307 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   163 TPRPVDIGSGGAHDVCVPGK------IRGHADMAYTLDSDPCGHCLIINNVNF-CPSSGLGTRTG 220
            ||..:.:|...|.......|      :..:|. .|.:.....|..||.|:..| .||  |.:|||
  Fly    38 TPESLVVGGATAASPLPANKFVARMPVERYAS-EYNMSHKHRGVALIFNHEFFDIPS--LKSRTG 99

Mouse   221 SNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFP 285
            :|:|..:|:..|..|.|.|.|..|...:.::..:.:.|..:|...||..|.|||||   .|    
  Fly   100 TNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGKAAELDHTDNDCLAVAILSHG---EH---- 157

Mouse   286 GAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDS 350
            |.:|..| ....::.|.:.|..:.||||.|||||||||||.|::.|.|.    |..:|.| ::|.
  Fly   158 GYLYAKD-TQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGI----TLEKGVT-ETDG 216

Mouse   351 EPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARS 415
            | .:..|:              :|..:|.|.||||.||:.|||:..:||||:::|...|....:.
  Fly   217 E-SSTSYK--------------IPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKK 266

Mouse   416 EDLQSLLL----RVA-------NAVSAKGTYKQIPGCFNFLRKKLFF 451
            .||.:||.    |||       .|.......||||...:.|.:.|.|
  Fly   267 YDLLTLLTFVNQRVALDFESNVPATPMMDRQKQIPCLTSMLTRILRF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp9NP_056548.2 CARD_CASP9 5..90 CDD:176740
CASc 190..452 CDD:237997 94/274 (34%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 93/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.