DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp9 and Strica

DIOPT Version :9

Sequence 1:NP_056548.2 Gene:Casp9 / 12371 MGIID:1277950 Length:454 Species:Mus musculus
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:317 Identity:84/317 - (26%)
Similarity:127/317 - (40%) Gaps:61/317 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   151 PARLKPEVLRPETPRP-VDIGSGG---------AHDVCVPGKIR---GHADMAYTLDSDPCGHCL 202
            |.::...:....||:| :.:||.|         |......|.|.   |.:..:.|.:........
  Fly   252 PKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVY 316

Mouse   203 IINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKND---LTAKKMVTALMEMAHRNHRA 264
            |.|:..|...:..  |.||..|...|...|..|:..|||..|   :|.||.|..|......:..|
  Fly   317 IFNHERFDNKNEF--RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSA 379

Mouse   265 LDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQ 329
            |   |:||||||.:  |.|....   .|..|:..:.:..|....   :|..||||.|:|||.|:.
  Fly   380 L---VLVILSHGTR--HDQIAAK---DDDYSLDDDVVFPILRNR---TLKDKPKLIFVQACKGDC 433

Mouse   330 KDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRD 394
            :..||                               ..||.....:|::||..|||:.||||:| 
  Fly   434 QLGGF-------------------------------MTDAAQPNGSPNEILKCYSTYEGFVSFR- 466

Mouse   395 KKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFF 451
            .:.|:.:|:||...|.:..::.|:.::::.|...|..:...:|||...:.|..|..|
  Fly   467 TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTSTLTSKYVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp9NP_056548.2 CARD_CASP9 5..90 CDD:176740
CASc 190..452 CDD:237997 73/265 (28%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 71/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6822
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.