DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp8 and Dcp-1

DIOPT Version :9

Sequence 1:NP_001264855.1 Gene:Casp8 / 12370 MGIID:1261423 Length:500 Species:Mus musculus
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:264 Identity:101/264 - (38%)
Similarity:136/264 - (51%) Gaps:34/264 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   248 YQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTAN 312
            |.|.:|.||..||. ||:|.    ||..|   |.|.||:.|.:.|.|.|:.|.|.:..:.||...
  Fly    71 YNMSHKHRGVALIF-NHEFF----DIPSL---KSRTGTNVDAQELKKAFENLGFAVSVHKDCKLR 127

Mouse   313 EIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIF 377
            :|.:.:......||.:.||....|||||:.|.:|..| .:..:.::..|||.:.||||:||||:|
  Fly   128 DILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKD-TQYKLDNIWHYFTATFCPSLAGKPKLF 191

Mouse   378 FIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNY-IPDEADFLLGMATVKNCVSYRDPVNGT 441
            |||||||.....|:..|.|      ..|.|..|..:| ||..||||...:|:....|:|:..||:
  Fly   192 FIQACQGDRLDGGITLEKG------VTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGS 250

Mouse   442 WYIQSLCQSLRERCPQGD--DILSILTGVNYDV-----SNKD-----DRRNKGKQMPQPTFTLRK 494
            ||:|||   :||....|.  |:|::||.||..|     ||..     ||:   ||:|..|..|.:
  Fly   251 WYMQSL---IRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQ---KQIPCLTSMLTR 309

Mouse   495 KLFF 498
            .|.|
  Fly   310 ILRF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp8NP_001264855.1 DED_Caspase_8_r1 23..104 CDD:260041
DD 118..199 CDD:387368
CASc 247..499 CDD:237997 101/264 (38%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 100/262 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.