DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp6 and Dcp-1

DIOPT Version :9

Sequence 1:NP_033941.3 Gene:Casp6 / 12368 MGIID:1312921 Length:276 Species:Mus musculus
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:272 Identity:105/272 - (38%)
Similarity:141/272 - (51%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 AEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTNADRDNLTRRFSDLGFEVKCFNDLRAEELLL 81
            |.:|.|.||.|||||||||| ||...:|..|.|||.|...|.:.|.:|||.|....|.:..::|.
  Fly    68 ASEYNMSHKHRGVALIFNHE-FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILK 131

Mouse    82 KIHEVSTSSHIDADCFICVFLSHGEGNHVYAYDAKIEIQTLTGLFKGDKCQSLVGKPKIFIIQAC 146
            .:.:.:...|.|.||.....|||||..::||.|.:.::..:...|....|.||.||||:|.||||
  Fly   132 HVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQAC 196

Mouse   147 RGSQHDVPVVPLDMVDHQTDKLD-------NVTQVD--AASVYTLPAGADFLMCYSVAEGYYSHR 202
            :|                 |:||       .||:.|  :::.|.:|..||||..||...||:|.|
  Fly   197 QG-----------------DRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWR 244

Mouse   203 ETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQRRVDFCKD----PDAIGKKQVPCFASM 263
            ...|||||:|.|...|...|...:...|||.||::|:   :||..:    |....:||:||..||
  Fly   245 NINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVA---LDFESNVPATPMMDRQKQIPCLTSM 306

Mouse   264 LTKKLHFCPKPS 275
            ||:.|.|..||:
  Fly   307 LTRILRFGDKPN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp6NP_033941.3 CASc 20..272 CDD:214521 102/264 (39%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 101/262 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm8756
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3066
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.