DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp3 and Decay

DIOPT Version :9

Sequence 1:NP_001271338.1 Gene:Casp3 / 12367 MGIID:107739 Length:277 Species:Mus musculus
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:294 Identity:100/294 - (34%)
Similarity:153/294 - (52%) Gaps:33/294 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 ENNKTSVDSKSI-----NNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGM 61
            ::.|...|:..|     :..::|.|..|:..:...|.:.:      ..||.:|:|:|:.   .|.
  Fly    14 KHKKDKADATKIAHTPTSELDLKRIIISRPTNEDTYENCA------RAGIALILNHKDV---KGQ 69

Mouse    62 SSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILSHGDEGV 126
            ..|.||:.|..::..|..|..:.||..:|||..:|.:.:..|::||||:...||..::|||.||.
  Fly    70 KQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGTEGK 134

Mouse   127 IYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGT--------DEEMA 183
            :|..:....:::|.:.|.||.|::|..|||||.||||||..|:..:|..|..        :...|
  Fly   135 VYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAA 199

Mouse   184 CQ----KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYA-------HKLEFMHILT 237
            .|    .||..||.|..|||...::|:||..||||||||||.:|...|       ..:|.:.:||
  Fly   200 VQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLT 264

Mouse   238 RVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTK 271
            .||||||.|::|.:.:...:..|::|..:|.|||
  Fly   265 AVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp3NP_001271338.1 CASc 37..277 CDD:214521 93/254 (37%)
DecayNP_477462.1 CASc 54..302 CDD:237997 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.