DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp2 and Drice

DIOPT Version :9

Sequence 1:NP_031636.1 Gene:Casp2 / 12366 MGIID:97295 Length:452 Species:Mus musculus
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:137/276 - (49%) Gaps:17/276 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse   165 LDNGDGPPCLLVKPCTPEFYQAHYQLAYRLQSQPRGLALVLSNVHFTGEKDLEFRSGGDVDHTTL 229
            |.||...|....:....:.....:...|.::.:.||:||:.::.||. ...|:.|:|.:||...|
  Fly    59 LANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFE-VPTLKSRAGTNVDCENL 122

Mouse   230 VTLFKLLGYNVHVLHDQTAQEMQEKLQNFAQLPAHRVTDSCVVALLSHGVEGGIYGVDGKLLQLQ 294
            ..:.|.|.:.|.|..|...:::...:: :|....|..:|..:||:||||..|.||..|.: .:|.
  Fly   123 TRVLKQLDFEVTVYKDCRYKDILRTIE-YAASQNHSDSDCILVAILSHGEMGYIYAKDTQ-YKLD 185

Mouse   295 EVFRLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHTQSPGCEESDAGKEELMKMRLP 359
            .::..|...:||||..|||:||||||:||..|.||..|  ::.|::.|        :..|..::|
  Fly   186 NIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQ--RSQTETDG--------DSSMSYKIP 240

Mouse   360 TRSDMICGYACLKGNAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKV-NALIKEREGYAPG 423
            ..:|.:..|:.:.|..:.|||.||||::::|....:.....:.:..:|..| ..:..:.|...|.
  Fly   241 VHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPD 305

Mouse   424 T-EFHRCKEMSEYCST 438
            | |.|:.|::.  |.|
  Fly   306 TPEMHQQKQIP--CIT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp2NP_031636.1 CARD_CASP2 32..118 CDD:260040
CASc 192..447 CDD:214521 77/249 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..349 5/21 (24%)
DriceNP_524551.2 CASc 86..330 CDD:214521 77/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.