Sequence 1: | NP_033939.1 | Gene: | Casp14 / 12365 | MGIID: | 1335092 | Length: | 257 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476974.1 | Gene: | Dcp-1 / 37729 | FlyBaseID: | FBgn0010501 | Length: | 323 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 61/207 - (29%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 37/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Mouse 16 YDMSGARLALTLCVT---------KAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFLE---- 67
Mouse 68 --ELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKNCKALRGKPKV 130
Mouse 131 YIIQACRGEHRDPGEEL-RGNEELGGDEELGGDEVAVLKNNPQSIPTYTDTLHIYSTVEGYLSYR 194
Mouse 195 HDEKGSGFIQTL 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Casp14 | NP_033939.1 | CASc | 10..257 | CDD:237997 | 61/207 (29%) |
Dcp-1 | NP_476974.1 | CASc | 71..313 | CDD:214521 | 61/207 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3573 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |