DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp12 and Drice

DIOPT Version :9

Sequence 1:XP_036010474.1 Gene:Casp12 / 12364 MGIID:1312922 Length:425 Species:Mus musculus
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster


Alignment Length:298 Identity:70/298 - (23%)
Similarity:123/298 - (41%) Gaps:44/298 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    86 SQEQLSLQFSNDEDDGPQKICTPSSPSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEV-- 148
            |.:|:.::..|           |..|::.    .|....|.:|.|..|.|:..:.|...|..:  
  Fly     9 SADQVGIRVGN-----------PEQPNDH----TDALGSVGSGGAGSSGLVAGSSHPYGSGAIGQ 58

Mouse   149 ----QDTLKLCPRDQFCKIKTERAKEIYPVMEKEGRTRLALIICNKKFDY--LFDRDNADTDILN 207
                ..:.....|....|:.|:|....|.:..|  ...:|||..::.|:.  |..|...:.|..|
  Fly    59 LANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHK--NRGMALIFNHEHFEVPTLKSRAGTNVDCEN 121

Mouse   208 MQELLENLGYSVVLKENLTAQEMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKP 272
            :..:|:.|.:.|.:.::...::: ...:::|....|..||...:..:|||.: |....|....|.
  Fly   122 LTRVLKQLDFEVTVYKDCRYKDI-LRTIEYAASQNHSDSDCILVAILSHGEM-GYIYAKDTQYKL 184

Mouse   273 DVLHDDTIFKIFNNSNCRSLRNKPKILIMQACRG-RYNGTIWVSTNKGIATADTDEERVLSCKWN 336
                 |.|:..|..::|.||..|||:..:|||:| |.:|.:.:..::    .:||.:..:|    
  Fly   185 -----DNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQ----TETDGDSSMS---- 236

Mouse   337 NSITKAHVETDFIAFKSSTPHNISWKVGKTGSLFISKL 374
               .|..|..||:...|:.|...||:....||.|:..|
  Fly   237 ---YKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp12XP_036010474.1 CARD_CASP1-like 12..94 CDD:260036 2/7 (29%)
CASc 172..423 CDD:214521 53/206 (26%)
DriceNP_524551.2 CASc 86..330 CDD:214521 53/206 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.