DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp12 and Decay

DIOPT Version :9

Sequence 1:XP_036010474.1 Gene:Casp12 / 12364 MGIID:1312922 Length:425 Species:Mus musculus
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:353 Identity:78/353 - (22%)
Similarity:133/353 - (37%) Gaps:96/353 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    97 DEDDGPQKICTPSSPSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFC 161
            |:.|..:...||:|..:.||                  ::::.|..      :||.:.|      
  Fly    18 DKADATKIAHTPTSELDLKR------------------IIISRPTN------EDTYENC------ 52

Mouse   162 KIKTERAKEIYPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLT 226
                             .|..:|||:.:|.......|...:.|..:|:..|:..|:.|...::||
  Fly    53 -----------------ARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLT 100

Mouse   227 AQEMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHD-DTIFKIFNNSNCR 290
            ..|:...|.:.| |.:|..:|...|..|||| .||....|      |:.:. :.::..|...||:
  Fly   101 FSEINDTLKEVA-REDHSQNDCFVLAVMSHG-TEGKVYAK------DMSYPVERLWNPFLGDNCK 157

Mouse   291 SLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVET-DFIAFKSS 354
            :|:||||:..:|||||.........::..:.|.:...|...:.:   .||.|...| |.:.|.|:
  Fly   158 TLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQ---PITYAIPSTADILVFYST 219

Mouse   355 TPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEE--------------------IFRKVQHSF- 398
            .....|::....||.||..|         |..|::                    :.|||.:.: 
  Fly   220 FDKFFSFRNVDDGSWFIQSL---------CRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQ 275

Mouse   399 -----EVPGELTQMPTIERVSMTRYFYL 421
                 |...::.:||.. ..::|:.|.|
  Fly   276 SNTKNEALNQMKEMPNF-MSTLTKTFQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp12XP_036010474.1 CARD_CASP1-like 12..94 CDD:260036
CASc 172..423 CDD:214521 67/278 (24%)
DecayNP_477462.1 CASc 54..302 CDD:237997 66/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842790
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.