DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp12 and Dcp-1

DIOPT Version :9

Sequence 1:XP_036010474.1 Gene:Casp12 / 12364 MGIID:1312922 Length:425 Species:Mus musculus
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:121/270 - (44%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   156 PRDQF-CKIKTERAKEIYPVMEKEGRTRLALIICNKKFDY--LFDRDNADTDILNMQELLENLGY 217
            |.::| .::..||....|.:..|  ...:|||..::.||.  |..|...:.|...:::..||||:
  Fly    54 PANKFVARMPVERYASEYNMSHK--HRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGF 116

Mouse   218 SVVLKENLTAQEMETELMQFAGRP---EHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDT 279
            :|.:.::...:    ::::..|:.   :|..:|...:..:||| ..|....|....|.     |.
  Fly   117 AVSVHKDCKLR----DILKHVGKAAELDHTDNDCLAVAILSHG-EHGYLYAKDTQYKL-----DN 171

Mouse   280 IFKIFNNSNCRSLRNKPKILIMQACRG-RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAH 343
            |:..|..:.|.||..|||:..:|||:| |.:|.|  :..||:  .:||.|       :::..|..
  Fly   172 IWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGI--TLEKGV--TETDGE-------SSTSYKIP 225

Mouse   344 VETDFIAFKSSTPHNISWKVGKTGSLFISKLIDCF----KKYCWCYHLEEIFRKVQHSFE--VPG 402
            :..||:...|:.|...||:....||.::..||...    |||.....|..:.::|...||  ||.
  Fly   226 IHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPA 290

Mouse   403 ELTQMPTIER 412
                .|.::|
  Fly   291 ----TPMMDR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp12XP_036010474.1 CARD_CASP1-like 12..94 CDD:260036
CASc 172..423 CDD:214521 67/253 (26%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 67/253 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.