DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp4 and Dcp-1

DIOPT Version :9

Sequence 1:NP_031635.2 Gene:Casp4 / 12363 MGIID:107700 Length:373 Species:Mus musculus
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:308 Identity:78/308 - (25%)
Similarity:122/308 - (39%) Gaps:78/308 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   103 KLCSPEEF-----------------TRLCREKTQEIYPIKEANGRTRKALIICNTEF---KHLSL 147
            |.|:||..                 .|:..|:....|.:..   :.|...:|.|.||   ..|..
  Fly    35 KGCTPESLVVGGATAASPLPANKFVARMPVERYASEYNMSH---KHRGVALIFNHEFFDIPSLKS 96

Mouse   148 RYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDF------AALSEHQTSDSTFLVLMSH 206
            |.|.|.|...:|...|:||:.|.|.:       :.:::|.      ||..:|..:|...:.::||
  Fly    97 RTGTNVDAQELKKAFENLGFAVSVHK-------DCKLRDILKHVGKAAELDHTDNDCLAVAILSH 154

Mouse   207 GTLHGICGTMHSEKTPDVLQY--DTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSK 269
            |. ||.   ::::.|    ||  |.|:..|....||.|..|||:..:|||:|             
  Fly   155 GE-HGY---LYAKDT----QYKLDNIWHYFTATFCPSLAGKPKLFFIQACQG------------- 198

Mouse   270 PQLCRGVDLPRNM-EADAVKLSH----VEKDFIAFYSTTPHHLSYRDKTGGSYFITRLISCFRKH 329
            .:|..|:.|.:.: |.|....:.    :..||:..|||.|.:.|:|:...||:::..||.....:
  Fly   199 DRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNAN 263

Mouse   330 ACSCHLFDIFLKVQQ----SFEKASIHSQMPTIDR--------ATLTR 365
            .....|..:...|.|    .||  |.....|.:||        :.|||
  Fly   264 GKKYDLLTLLTFVNQRVALDFE--SNVPATPMMDRQKQIPCLTSMLTR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp4NP_031635.2 Required for LPS-binding. /evidence=ECO:0000269|PubMed:25119034 1..59
CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 72/272 (26%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 72/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.