DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp4 and Strica

DIOPT Version :9

Sequence 1:NP_031635.2 Gene:Casp4 / 12363 MGIID:107700 Length:373 Species:Mus musculus
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:308 Identity:66/308 - (21%)
Similarity:117/308 - (37%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    91 EMEEPEESLNTLKLCSPEEFTRL-----CREKTQEIYPIKEANGRTRKALIICNTE--------- 141
            ::::|..|..|     |:.|..|     .:.|...:...::|.|....:|.|..:.         
  Fly   254 QVDKPLSSTAT-----PKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPA 313

Mouse   142 ----FKH------LSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMES-----EMKDFAALS 191
                |.|      ...|.|:..|:..::...|.|...|.|..:.|...::.     :.|||    
  Fly   314 RVYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDF---- 374

Mouse   192 EHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRG 256
              :...:..||::||||.|........:.:   |..|.::.|..|   ..|:||||:|.||||:|
  Fly   375 --EDKSALVLVILSHGTRHDQIAAKDDDYS---LDDDVVFPILRN---RTLKDKPKLIFVQACKG 431

Mouse   257 GNSGEMWIRESSKPQLCR-GVDLPRNMEADAVKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFIT 320
            .               |: |     ....||.:.:....:.:..|||....:|:|.: .|:.||.
  Fly   432 D---------------CQLG-----GFMTDAAQPNGSPNEILKCYSTYEGFVSFRTE-DGTPFIQ 475

Mouse   321 RLISCFRKHACSCHLFDIFLKVQQSFEKASIHSQMPTIDRATLTRYFY 368
            .|.....:...:..:..|.:.|:|..:..|...|:|::.....::|.:
  Fly   476 TLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTSTLTSKYVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp4NP_031635.2 Required for LPS-binding. /evidence=ECO:0000269|PubMed:25119034 1..59
CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 59/272 (22%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 55/244 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.