DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp1 and Drice

DIOPT Version :9

Sequence 1:NP_033937.2 Gene:Casp1 / 12362 MGIID:96544 Length:402 Species:Mus musculus
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:109/249 - (43%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse   163 LALIICNTEFQ--HLSPRVGAQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKT 225
            :|||..:..|:  .|..|.|..||...:..:|:.|.:.|.|.::....::::.: |:||...|..
  Fly    95 MALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTI-EYAASQNHSD 158

Mouse   226 SDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEK-Q 289
            ||...:..:|||..    |..|:.:..  .|:|.|:.......||||..|||:..||||:|:: .
  Fly   159 SDCILVAILSHGEM----GYIYAKDTQ--YKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLD 217

Mouse   290 GVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKH 354
            |.|.::.|..:::.|        .....|..:..||:...|:.|...|||:..|||.|::||...
  Fly   218 GGVTMQRSQTETDGD--------SSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAE 274

Mouse   355 MKEYAWSCD----LEDIFRKVRFSFEQ-----PEFRLQMPTADRVTLTKRFYLF 399
            :.......|    |..:.::|...||.     ||...|.......|:..|...|
  Fly   275 LAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp1NP_033937.2 CARD_CASP1-like 6..87 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..125
CASc 152..400 CDD:214521 68/249 (27%)
DriceNP_524551.2 CASc 86..330 CDD:214521 68/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.