DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp1 and Decay

DIOPT Version :9

Sequence 1:NP_033937.2 Gene:Casp1 / 12362 MGIID:96544 Length:402 Species:Mus musculus
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:318 Identity:79/318 - (24%)
Similarity:133/318 - (41%) Gaps:59/318 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse   113 ETKEEQNKEDGTFPGLTGTLKFCPLEKAQKLWKENPS--EIYPIMNTTTRTRLALIICNTEFQHL 175
            :.|.:::|.|.|....|.|.:.    ..:::....|:  :.|   ....|..:|||:.:.:.:..
  Fly    12 KNKHKKDKADATKIAHTPTSEL----DLKRIIISRPTNEDTY---ENCARAGIALILNHKDVKGQ 69

Mouse   176 SPRVGAQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE 240
            ..|||.:.|..:|:..|:..|:.|:..::||..|:...:||.|. .:|..:|...|..||||.: 
  Fly    70 KQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAR-EDHSQNDCFVLAVMSHGTE- 132

Mouse   241 GICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRDSEEDF 305
               |..|:.::|  ..|:.::.......|.:||:|||:..||||||..     |:.:|..|....
  Fly   133 ---GKVYAKDMS--YPVERLWNPFLGDNCKTLKNKPKLFFIQACRGAN-----LEKAVEFSSFAV 187

Mouse   306 LTDAIFEDDGIKKAHI------EKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCD- 363
            :|..:..:.......|      ..|.:.|.|:.....|:|:...||.||:||.:.:.:.|.:.. 
  Fly   188 MTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAA 252

Mouse   364 ----------LEDIFRKVRFSF-------------EQPEFRLQMPTADRVTLTKRFYL 398
                      |..:.|||.:.:             |.|.|        ..||||.|.|
  Fly   253 TPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNF--------MSTLTKTFQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp1NP_033937.2 CARD_CASP1-like 6..87 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..125 3/11 (27%)
CASc 152..400 CDD:214521 72/277 (26%)
DecayNP_477462.1 CASc 54..302 CDD:237997 70/267 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.