DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Casp1 and Dcp-1

DIOPT Version :9

Sequence 1:NP_033937.2 Gene:Casp1 / 12362 MGIID:96544 Length:402 Species:Mus musculus
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:313 Identity:86/313 - (27%)
Similarity:138/313 - (44%) Gaps:45/313 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    79 EDC----YLAGILELQSAPSAETFVATE--DSKGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPL 137
            ::|    |..||.....:.:..:|:..:  |:||..|.|..              :.|.....||
  Fly     3 DECVTRNYGVGIRSPNGSENRGSFIMADNTDAKGCTPESLV--------------VGGATAASPL 53

Mouse   138 EKAQKLWKENPSEIYPI-MNTTTRTRLALIICNTEF---QHLSPRVGAQVDLREMKLLLEDLGYT 198
             .|.|.....|.|.|.. .|.:.:.|...:|.|.||   ..|..|.|..||.:|:|...|:||:.
  Fly    54 -PANKFVARMPVERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFA 117

Mouse   199 VKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQM 263
            |.|.::....:::|.|.: ||..:|..:|...:..:|||..    |..|:.:..  .|:|.|:..
  Fly   118 VSVHKDCKLRDILKHVGK-AAELDHTDNDCLAVAILSHGEH----GYLYAKDTQ--YKLDNIWHY 175

Mouse   264 MNTLKCPSLKDKPKVIIIQACRGEK-QGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIA 327
            .....||||..|||:..||||:|:: .|.:.|:..|.:::.:..|.        .|..|..||:.
  Fly   176 FTATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTS--------YKIPIHADFLF 232

Mouse   328 FCSSTPDNVSWRHPVRGSLFIESLIKHM----KEYAWSCDLEDIFRKVRFSFE 376
            ..|:.|...|||:...||.:::|||:.:    |:|.....|..:.::|...||
  Fly   233 SYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Casp1NP_033937.2 CARD_CASP1-like 6..87 CDD:260036 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..125 6/28 (21%)
CASc 152..400 CDD:214521 69/234 (29%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.