DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nr1i3 and Hr96

DIOPT Version :9

Sequence 1:NP_033933.2 Gene:Nr1i3 / 12355 MGIID:1346307 Length:358 Species:Mus musculus
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:98 Identity:42/98 - (42%)
Similarity:63/98 - (64%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 PRNCVVCGDRATGYHFHALTCEGCKGFFRRTVSKTIGPICPFAGRCEVSKAQRRHCPACRLQKCL 82
            |:||.||||:|.||:|:|:|||.||.||||.........|||...|:::...||.|..|||:|||
  Fly     4 PKNCAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCL 68

Mouse    83 NVGMRKDMILSAEALALRRARQAQRRAEKASLQ 115
            ::||:.:.|:|.|...::|.:....||::..::
  Fly    69 DIGMKSENIMSEEDKLIKRRKIETNRAKRRLME 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nr1i3NP_033933.2 NR_DBD_VDR_like 21..92 CDD:143531 34/70 (49%)
NR_LBD 116..356 CDD:299703 42/98 (43%)
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 41/92 (45%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847979
Domainoid 1 1.000 99 1.000 Domainoid score I7064
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4095
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X988
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.