powered by:
Protein Alignment LRRC28 and NGL3
DIOPT Version :9
Sequence 1: | NP_001308604.1 |
Gene: | LRRC28 / 123355 |
HGNCID: | 28355 |
Length: | 367 |
Species: | Homo sapiens |
Sequence 2: | NP_013588.1 |
Gene: | NGL3 / 854921 |
SGDID: | S000004587 |
Length: | 505 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 54 |
Identity: | 14/54 - (25%) |
Similarity: | 25/54 - (46%) |
Gaps: | 12/54 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 273 LQELAMRGLYHTYHSLLK-DLN-------FLS----PISLPRSLLELLHCPLGH 314
:||:.....|:.:||||. |.| :|: |:.|...:..::.|.|.:
Yeast 275 IQEIKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAY 328
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.