DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRC28 and NGL3

DIOPT Version :9

Sequence 1:NP_001308604.1 Gene:LRRC28 / 123355 HGNCID:28355 Length:367 Species:Homo sapiens
Sequence 2:NP_013588.1 Gene:NGL3 / 854921 SGDID:S000004587 Length:505 Species:Saccharomyces cerevisiae


Alignment Length:54 Identity:14/54 - (25%)
Similarity:25/54 - (46%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   273 LQELAMRGLYHTYHSLLK-DLN-------FLS----PISLPRSLLELLHCPLGH 314
            :||:.....|:.:||||. |.|       :|:    |:.|...:..::.|.|.:
Yeast   275 IQEIKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRC28NP_001308604.1 LRR 1 16..36
LRR 2 42..63
leucine-rich repeat 43..66 CDD:275380
NEL <46..>306 CDD:330839 12/44 (27%)
LRR 3 66..87
leucine-rich repeat 67..89 CDD:275380
LRR 4 89..110
leucine-rich repeat 90..135 CDD:275380
LRR 5 112..133
LRR 6 135..156
leucine-rich repeat 136..158 CDD:275380
LRR 7 158..180
leucine-rich repeat 159..181 CDD:275380
LRR 8 181..202
leucine-rich repeat 182..204 CDD:275380
LRR 9 204..226
NGL3NP_013588.1 CCR4 67..496 CDD:227564 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.