DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk4 and CG10126

DIOPT Version :9

Sequence 1:XP_006525606.1 Gene:Camk4 / 12326 MGIID:88258 Length:497 Species:Mus musculus
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:198 Identity:39/198 - (19%)
Similarity:71/198 - (35%) Gaps:59/198 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse   280 NCEYYFISPWWDEVSLNA------KDLVKKLIVLDPKKRLT-------TFQAL---------QHP 322
            ||:.|.:.......:|..      ||.:.||.:|...:..|       .|:|:         :..
  Fly    17 NCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEE 81

Mouse   323 WVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTSIQENHKASSDPPSTQ 387
            ::||  .....:|.:::::::..|            .....||.|.:.|......:    ||..|
  Fly    82 FITG--IRDTGLDVSEEEIKQMFA------------TFDEDGSGSINMTEFLLKLR----PPMPQ 128

Mouse   388 DAKDSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQS--EEVEKDAGVKEEETSSMVPQDPEDEL 450
            ...:..|....||   |::||.|   .:..:::.:.|  |..:..:|.|.           |||:
  Fly   129 SRLNIIDQAFNKM---DRDEDGV---ITIQDLKNVYSVKEHPKYQSGEKS-----------EDEI 176

Mouse   451 ETD 453
            .||
  Fly   177 LTD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk4XP_006525606.1 STKc_CaMKIV 66..359 CDD:270987 16/100 (16%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 10/70 (14%)
EFh 64..119 CDD:238008 10/68 (15%)
EFh 97..154 CDD:238008 15/78 (19%)
EF-hand_7 98..158 CDD:290234 15/81 (19%)
EF-hand_7 134..204 CDD:290234 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.