DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk2g and lok

DIOPT Version :9

Sequence 1:XP_006518551.1 Gene:Camk2g / 12325 MGIID:88259 Length:588 Species:Mus musculus
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:269 Identity:98/269 - (36%)
Similarity:153/269 - (56%) Gaps:11/269 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 YQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLS-AR------DHQKLEREARICRLLKHP 71
            |.:..:||.||:.:||......:.|::|.||:....|| ||      |..::..||:|.:.|.||
  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238

Mouse    72 NIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRD 136
            .:||:||.:.:....|:|.:.:.||:|...|::.:..||..:....:|:..:|.::|...|.|||
  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303

Mouse   137 LKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVL---RKDPYGKPVDIW 198
            |||:|:||.:..:...:|::||||:..|| :........|||.|::||||   .::.|.|.||||
  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQ-KDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIW 367

Mouse   199 ACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITA 263
            :.||:|:..|.|..||.||......||||.|.:.:..|.|.:|:..||.||||||.::|.:|.:.
  Fly   368 SLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSI 432

Mouse   264 DQALKHPWV 272
            |..|:..|:
  Fly   433 DDVLQSSWL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk2gXP_006518551.1 STKc_CaMKII 12..303 CDD:270988 98/269 (36%)
CaMKII_AD 456..583 CDD:285524
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 97/267 (36%)
S_TKc 174..441 CDD:214567 97/267 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.