DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk2b and CaMKI

DIOPT Version :9

Sequence 1:XP_006514527.1 Gene:Camk2b / 12323 MGIID:88257 Length:667 Species:Mus musculus
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:383 Identity:146/383 - (38%)
Similarity:207/383 - (54%) Gaps:37/383 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 DEYQLYEDIGKGAFSVVRRC-VKLCTGHEYAAKIINTKKLSARDHQKLEREARICR--------- 66
            ::|.|:..:|.||||.||.. .|...|..:|.|||:.|.|..:: :.||.|.|:.|         
  Fly    29 EKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE-ESLENEIRVLRRFSANHFDG 92

Mouse    67 ------LLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVL 125
                  .|.|.|||:|.::..::...|||.:||||||||:.||.:..|:|.||||.|:||||||.
  Fly    93 KCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVD 157

Mouse   126 HCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLA-IEVQGDQQAWFGFAGTPGYLSPEVLRKE 189
            :.|:.|||||||||||||..|....:.:.::||||: :|..|....   ..|||||::||||.::
  Fly   158 YMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMAT---ACGTPGYVAPEVLAQK 219

Mouse   190 AYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLT 254
            .|||.||:|:.|||.||||.|||||:||:...|:.||..|.::|.||.||.::..||:.|..::.
  Fly   220 PYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMC 284

Mouse   255 INPAKRITAHEALKHPWVCQRSTVASMMHRQETV-ECLKKFNARRKLKGAILTTML--------- 309
            :...||.|..:||.|.|:......:..:|  .|| |.|||..|:.:.|.|.....:         
  Fly   285 VTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMAL 347

Mouse   310 ---ATRNFSVGRQTTAPATMSTAASGTTMGLVEQAAKSLLNKKADGVKPQTNSTKNSS 364
               :..||.....:...:|..|||:|.....|..:.:| :...|..:.....||..:|
  Fly   348 NSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQS-VQSHAQEMNKSGGSTNAAS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk2bXP_006514527.1 STKc_CaMKII 12..303 CDD:270988 132/308 (43%)
CaMKII_AD 535..662 CDD:285524
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 122/275 (44%)
S_TKc 31..302 CDD:214567 122/274 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.