DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LEO1 and zormin

DIOPT Version :10

Sequence 1:NP_001310832.1 Gene:LEO1 / 123169 HGNCID:30401 Length:688 Species:Homo sapiens
Sequence 2:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster


Alignment Length:695 Identity:136/695 - (19%)
Similarity:235/695 - (33%) Gaps:225/695 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   136 EKAHSDDEKWGREDKSDQSDD---------------------EKIQN-SDDEERAQGSDEDKLQN 178
            ||..||:|:  ...||.|.|.                     ||:.| ..|.||||    |::| 
  Fly   757 EKVMSDNEE--TVAKSTQVDTQLYPVFTSQSVDSKQLLISTREKLTNVIQDIERAQ----DEIQ- 814

Human   179 SDDDEKMQNT---DDEERPQLSDDER-----QQLSEEEKANSDDERPVAS------DNDDEKQNS 229
                :::|.|   ..:::|.|:..|:     :.|..:......|.|.:..      :|..:.:..
  Fly   815 ----QRIQTTLGIQTKDQPSLAKIEQVINNLRMLKAKLDGIKYDYRTLVESVIQFLENIVQLRRE 875

Human   230 DDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKSES--------------ARGSDSE 280
            .|:   ..:.::|...|..:|..|..|:.|....::.:...::|              ||..|: 
  Fly   876 IDD---YFARQQKEPASGADRSIAEHEKFRDQCMDKFRSLITQSELLIDRVRVLEPPGAREIDT- 936

Human   281 DEVLRMK-------RKNAIASDSEADSDTEVPKDNSGTMDLFGGADDISSGSDGEDKPPTPGQPV 338
            |.:|::.       ..|:.|..|..:...::.:..|...|:....|.:|     :.......|.|
  Fly   937 DRILKLLENLRLHFESNSSARMSTLERLEKIEQFRSDLEDIDRSLDSVS-----QQLHEINNQSV 996

Human   339 D-------------------ENGLPQDQQEEEPIPETR--------------IEVEIPKVNTDLG 370
            |                   |..:|:.      :..||              :|..|.|......
  Fly   997 DSLAAAKTTSLAFEYFERTIECSMPRQ------LKSTRHQRRWGQTAHTIELLEKRIEKFTESTS 1055

Human   371 NDLYFVKLPNFLSVEPRPFDPQYYEDE----------------------------FEDEEMLDEE 407
            ..|:..          .|...:|.:||                            ||..|.:|.|
  Fly  1056 QQLFIT----------NPESERYVKDELRKLNEKWQSFKDQVKQKRKSLNQATDFFEVVEKIDAE 1110

Human   408 GR--TRLKLKVENTIRWRIRRDEEGNEIKESNARIV--------KWSDGSMSLHLGNEVFDVYKA 462
            .|  :.....|.|.:.:.....|.||.:.:....:.        |....|...|..|:|..:|  
  Fly  1111 YREISYFYTSVSNKVPYLRDSVEAGNLVNDIENYVTSREAALRSKLDSASQCAHDMNKVSSLY-- 1173

Human   463 PLQGDHNHLFIRQGTGLQGQAVFKTKLTFRPHSTDSATHRKMTLSLADRCSKTQKIRILPMAGRD 527
               .|..::|         |:..|.|:..      :....::.   .::..|.|:.|    ..||
  Fly  1174 ---NDVMNIF---------QSFIKLKMDI------NVVQERLK---QEQRQKEQRER----DARD 1213

Human   528 PECQRTEMIKKEEERLRASIRRESQQRRMREKQH------QRGLSASYLEPDRYDEEEEGEESIS 586
             :.:|.:.||:.|.:.|  :.||.|.|...::|.      ||.|:|..|   ...|:...||...
  Fly  1214 -QAEREKAIKEAEAKER--LHREEQSRLENQRQQAAIEQAQRELAAREL---ALREQAVREEEAR 1272

Human   587 LAAIKNR-------YKGGIREERARIYS-SDSDEGSEEDKAQRLL--KAKKLTSDEESGKRE--- 638
            |.||:.:       .:...|||..||.| .|.....||.:.|.:.  :.:....:||..:||   
  Fly  1273 LQAIREQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIRRENES 1337

Human   639 RPKLKETWRQWKGEVSRPTLSFLRQNRKVNLPEREKQKMMIKQIK 683
            |.|.:|..|..:.|::|  |..||.       :.::|:::.:.|:
  Fly  1338 RSKREEEARIQREEITR--LQTLRD-------QVDQQRIVTENIR 1373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LEO1NP_001310832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..357 53/296 (18%)
MSCRAMM_ClfA <9..361 CDD:468110 56/314 (18%)
Leo1 374..536 CDD:461126 32/199 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..583 11/41 (27%)
zorminNP_001261317.1 SPEC 126..332 CDD:238103
SPEC <504..641 CDD:413338
SMC_prok_B 654..>1389 CDD:274008 136/695 (20%)
Smc <1192..>1377 CDD:440809 51/204 (25%)
I-set 1390..1479 CDD:400151
Ig strand B 1407..1411 CDD:409564
Ig strand C 1420..1424 CDD:409564
Ig strand E 1445..1449 CDD:409564
Ig strand F 1459..1464 CDD:409564
Ig strand G 1472..1475 CDD:409564
I-set 1491..1580 CDD:400151
Ig strand B 1508..1512 CDD:409353
Ig strand C 1521..1525 CDD:409353
Ig strand E 1546..1550 CDD:409353
Ig strand F 1560..1565 CDD:409353
Ig strand G 1573..1576 CDD:409353
I-set 1589..1675 CDD:400151
Ig strand B 1606..1610 CDD:409353
Ig strand C 1619..1623 CDD:409353
Ig strand E 1641..1645 CDD:409353
Ig strand F 1655..1660 CDD:409353
Ig strand G 1668..1671 CDD:409353
I-set 1702..1786 CDD:400151
Ig strand B 1714..1718 CDD:409353
Ig strand C 1727..1731 CDD:409353
Ig strand E 1752..1756 CDD:409353
Ig strand F 1766..1771 CDD:409353
Ig strand G 1779..1782 CDD:409353
I-set 1811..1902 CDD:400151
Ig strand B 1828..1832 CDD:409353
Ig strand C 1841..1845 CDD:409353
Ig strand E 1868..1872 CDD:409353
Ig strand F 1882..1887 CDD:409353
I-set 1927..2015 CDD:400151
Ig strand B 1944..1948 CDD:409353
Ig strand C 1957..1961 CDD:409353
Ig strand E 1981..1985 CDD:409353
Ig strand F 1995..2000 CDD:409353
Ig strand G 2008..2011 CDD:409353
Ig 2142..2231 CDD:472250
Ig strand B 2159..2163 CDD:409353
Ig strand C 2172..2176 CDD:409353
Ig strand E 2197..2201 CDD:409353
Ig strand F 2211..2216 CDD:409353
Ig strand G 2224..2227 CDD:409353
I-set 2238..2325 CDD:400151
Ig strand B 2255..2259 CDD:409353
Ig strand C 2268..2272 CDD:409353
Ig strand F 2309..2314 CDD:409353
PHA03247 <2593..2893 CDD:223021
I-set 3566..3655 CDD:400151
Ig strand B 3583..3587 CDD:409353
Ig strand C 3596..3600 CDD:409353
Ig strand E 3621..3625 CDD:409353
Ig strand F 3635..3640 CDD:409353
Ig strand G 3648..3651 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.